Lineage for d4lhob_ (4lho B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961500Species Coryneform bacterium [TaxId:1728] [189898] (4 PDB entries)
  8. 2961514Domain d4lhob_: 4lho B: [224669]
    automated match to d3mjza_
    complexed with po4, pr6

Details for d4lhob_

PDB Entry: 4lho (more details), 2.22 Å

PDB Description: Crystal Structure of FG41Malonate Semialdehyde Decarboxylase inhibited by 3-bromopropiolate
PDB Compounds: (B:) FG41 Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d4lhob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhob_ d.80.1.0 (B:) automated matches {Coryneform bacterium [TaxId: 1728]}
pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
aqyvtgelaip

SCOPe Domain Coordinates for d4lhob_:

Click to download the PDB-style file with coordinates for d4lhob_.
(The format of our PDB-style files is described here.)

Timeline for d4lhob_: