Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-src tyrosine kinase [56155] (3 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (56 PDB entries) |
Domain d4lghb_: 4lgh B: [224665] automated match to d2z8ca1 complexed with 0jn |
PDB Entry: 4lgh (more details), 2.84 Å
SCOPe Domain Sequences for d4lghb_:
Sequence, based on SEQRES records: (download)
>d4lghb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr heklvqlyavvseepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayve rmnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygr ftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqc wrkdpeerptfeylqafledyftstepqyqpgenl
>d4lghb_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]} aweipreslrlevklgqcfgevwmgtwngttrvaiktlkpeaqvmkklrheklvqlyavv seepiyivgeymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlra anilvgenlvckvadfglpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgm vnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepq yqpgenl
Timeline for d4lghb_: