SCOPe 2.07: Domain d4ldfa_: 4ldf A:

Lineage for d4ldfa_ (4ldf A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [224846] (2 PDB entries)

8. Domain d4ldfa_: 4ldf A: [224654]
   automated match to d1e6ia_
   complexed with gol, unx

Details for d4ldfa_

PDB Entry: 4ldf, 2 Å

PDB Description: crystal structure of cpbrd2 from cryptosporidium, cgd3_3190

PDB Compounds: (A:) GCN5 like acetylase + bromodomain

SCOPe Domain Sequences for d4ldfa_:

Sequence; same for both SEQRES and ATOM records:

>d4ldfa_ a.29.2.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
kvdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkey
ktlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe

Timeline for d4ldfa_:

• d4ldfa_ first appeared in SCOPe 2.03
  
• d4ldfa_ appears in SCOPe 2.06
  
• d4ldfa_ appears in the current release, SCOPe 2.08