SCOP 1.69: Domain d1ctm_1: 1ctm 1-167,231-250

Lineage for d1ctm_1 (1ctm 1-167,231-250)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family)

5. Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)

6. Protein Cytochrome f, large domain [49443] (4 species)
   this domain is interrupted by a small domain which is barrel-sandwich hybrid fold

7. Species Turnip (Brassica rapa) [TaxId:3711] [49444] (2 PDB entries)

8. Domain d1ctm_1: 1ctm 1-167,231-250 [22465]
   Other proteins in same PDB: d1ctm_2

Details for d1ctm_1

PDB Entry: 1ctm, 2.3 Å

PDB Description: crystal structure of chloroplast cytochrome f reveals a novel cytochrome fold and unexpected heme ligation

SCOP Domain Sequences for d1ctm_1:

Sequence; same for both SEQRES and ATOM records:

>d1ctm_1 b.2.6.1 (1-167,231-250) Cytochrome f, large domain {Turnip (Brassica rapa)}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnXpnvggfgqgdae
ivlqdplr

Timeline for d1ctm_1:

• d1ctm_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ctm_1 appears in SCOP 1.67
  
• d1ctm_1 appears in SCOP 1.71
  
• d1ctm_1 appears in the current release, SCOPe 2.08, called d1ctma1