Class b: All beta proteins [48724] (144 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) |
Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) |
Protein Cytochrome f, large domain [49443] (4 species) this domain is interrupted by a small domain which is barrel-sandwich hybrid fold |
Species Turnip (Brassica rapa) [TaxId:3711] [49444] (2 PDB entries) |
Domain d1ctm_1: 1ctm 1-167,231-250 [22465] Other proteins in same PDB: d1ctm_2 |
PDB Entry: 1ctm (more details), 2.3 Å
SCOP Domain Sequences for d1ctm_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ctm_1 b.2.6.1 (1-167,231-250) Cytochrome f, large domain {Turnip (Brassica rapa)} ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnXpnvggfgqgdae ivlqdplr
Timeline for d1ctm_1: