Lineage for d4lbxa1 (4lbx A:-1-328)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904823Species Rhizobium etli [TaxId:347834] [226336] (19 PDB entries)
  8. 2904850Domain d4lbxa1: 4lbx A:-1-328 [224642]
    Other proteins in same PDB: d4lbxa2
    automated match to d1lioa_
    complexed with adn, ctn, dms, k

Details for d4lbxa1

PDB Entry: 4lbx (more details), 1.7 Å

PDB Description: Crystal structure of probable sugar kinase protein from Rhizobium Etli CFN 42 complexed with cytidine
PDB Compounds: (A:) Probable sugar kinase protein

SCOPe Domain Sequences for d4lbxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbxa1 c.72.1.0 (A:-1-328) automated matches {Rhizobium etli [TaxId: 347834]}
mtrfdvltvgnaivdiisrcndqflidnqitkaamnlidaeraellysrmgpaleasggs
agntaagvanlggkaayfgnvaadqlgdifthdiraqgvhyqtkpkgafpptarsmifvt
edgersmntylgacvelgpedveadvvadakvtyfegylwdpprakeaildcariahqhg
remsmtlsdsfcvdryrgefldlmrsgkvdivfanrqealslyqtddfeealnriaadck
iaavtmsengavilkgreryyvnairirevvdttgagdlfasgflygytqgrsledcgkl
gclaagiviqqigprpmtslseaakqagli

SCOPe Domain Coordinates for d4lbxa1:

Click to download the PDB-style file with coordinates for d4lbxa1.
(The format of our PDB-style files is described here.)

Timeline for d4lbxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lbxa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lbxb_