Lineage for d1hcz_1 (1hcz 1-167,231-250)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 552572Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 552933Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 552934Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 552935Protein Cytochrome f, large domain [49443] (4 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 552957Species Turnip (Brassica rapa) [TaxId:3711] [49444] (2 PDB entries)
  8. 552958Domain d1hcz_1: 1hcz 1-167,231-250 [22464]
    Other proteins in same PDB: d1hcz_2
    complexed with hem

Details for d1hcz_1

PDB Entry: 1hcz (more details), 1.96 Å

PDB Description: lumen-side domain of reduced cytochrome f at-35 degrees celsius

SCOP Domain Sequences for d1hcz_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcz_1 b.2.6.1 (1-167,231-250) Cytochrome f, large domain {Turnip (Brassica rapa)}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnXpnvggfgqgdae
ivlqdplr

SCOP Domain Coordinates for d1hcz_1:

Click to download the PDB-style file with coordinates for d1hcz_1.
(The format of our PDB-style files is described here.)

Timeline for d1hcz_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hcz_2