SCOPe 2.03: Domain d4l9qb1: 4l9q B:5-196

Lineage for d4l9qb1 (4l9q B:5-196)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (74 PDB entries)
   Uniprot P02768 29-596

8. Domain d4l9qb1: 4l9q B:5-196 [224609]
   automated match to d1n5ua1
   complexed with 9tp

Details for d4l9qb1

PDB Entry: 4l9q, 2.7 Å

PDB Description: X-ray study of human serum albumin complexed with teniposide

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4l9qb1:

Sequence; same for both SEQRES and ATOM records:

>d4l9qb1 a.126.1.1 (B:5-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
slhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmc
tafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpklde
lrdegkassakq

Timeline for d4l9qb1:

• d4l9qb1 is new in SCOPe 2.03-stable
  
• d4l9qb1 appears in SCOPe 2.04
  
• d4l9qb1 appears in the current release, SCOPe 2.08