Lineage for d1bf5a2 (1bf5 A:317-568)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768333Family b.2.5.5: STAT DNA-binding domain [81317] (4 proteins)
  6. 2768338Protein STAT-1, DNA-binding domain [49435] (1 species)
  7. 2768339Species Human (Homo sapiens) [TaxId:9606] [49436] (1 PDB entry)
  8. 2768340Domain d1bf5a2: 1bf5 A:317-568 [22460]
    Other proteins in same PDB: d1bf5a1, d1bf5a3
    includes most of the linker with SH2 domain
    protein/DNA complex

Details for d1bf5a2

PDB Entry: 1bf5 (more details), 2.9 Å

PDB Description: tyrosine phosphorylated stat-1/dna complex
PDB Compounds: (A:) signal transducer and activator of transcription 1-alpha/beta

SCOPe Domain Sequences for d1bf5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf5a2 b.2.5.5 (A:317-568) STAT-1, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
fvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnerntvkg
frkfnilgthtkvmnmeestngslaaefrhlqlkeqknagtrtnegplivteelhslsfe
tqlcqpglvidlettslpvvvisnvsqlpsgwasilwynmlvaeprnlsffltppcarwa
qlsevlswqfssvtkrglnvdqlnmlgekllgpnaspdglipwtrfckenindknfpfwl
wiesilelikkh

SCOPe Domain Coordinates for d1bf5a2:

Click to download the PDB-style file with coordinates for d1bf5a2.
(The format of our PDB-style files is described here.)

Timeline for d1bf5a2: