![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.5: STAT DNA-binding domain [81317] (4 proteins) |
![]() | Protein STAT-1, DNA-binding domain [49435] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49436] (1 PDB entry) |
![]() | Domain d1bf5a2: 1bf5 A:317-568 [22460] Other proteins in same PDB: d1bf5a1, d1bf5a3 includes most of the linker with SH2 domain protein/DNA complex |
PDB Entry: 1bf5 (more details), 2.9 Å
SCOPe Domain Sequences for d1bf5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf5a2 b.2.5.5 (A:317-568) STAT-1, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} fvverqpcmpthpqrplvlktgvqftvklrllvklqelnynlkvkvlfdkdvnerntvkg frkfnilgthtkvmnmeestngslaaefrhlqlkeqknagtrtnegplivteelhslsfe tqlcqpglvidlettslpvvvisnvsqlpsgwasilwynmlvaeprnlsffltppcarwa qlsevlswqfssvtkrglnvdqlnmlgekllgpnaspdglipwtrfckenindknfpfwl wiesilelikkh
Timeline for d1bf5a2: