SCOPe 2.07: Domain d4l5nb_: 4l5n B:

Lineage for d4l5nb_ (4l5n B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein automated matches [190540] (4 species)
   not a true protein

7. Species Herpes simplex virus type 1 [TaxId:10299] [226744] (2 PDB entries)

8. Domain d4l5nb_: 4l5n B: [224566]
   automated match to d1laue_
   protein/DNA complex; complexed with act

Details for d4l5nb_

PDB Entry: 4l5n, 2.16 Å

PDB Description: Crystallographic Structure of HHV-1 Uracil-DNA Glycosylase complexed with the Bacillus phage PZA inhibitor protein p56

PDB Compounds: (B:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4l5nb_:

Sequence; same for both SEQRES and ATOM records:

>d4l5nb_ c.18.1.1 (B:) automated matches {Herpes simplex virus type 1 [TaxId: 10299]}
dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d4l5nb_:

• d4l5nb_ first appeared in SCOPe 2.03
  
• d4l5nb_ appears in SCOPe 2.06
  
• d4l5nb_ appears in the current release, SCOPe 2.08