Lineage for d1nfic2 (1nfi C:20-189)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10414Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 10415Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 10443Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (2 species)
  7. 10444Species Human (Homo sapiens) [TaxId:9606] [49430] (1 PDB entry)
  8. 10446Domain d1nfic2: 1nfi C:20-189 [22456]
    Other proteins in same PDB: d1nfia1, d1nfib_, d1nfic1, d1nfid_, d1nfie_, d1nfif_

Details for d1nfic2

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

SCOP Domain Sequences for d1nfic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfic2 b.2.5.1 (C:20-189) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens)}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrap

SCOP Domain Coordinates for d1nfic2:

Click to download the PDB-style file with coordinates for d1nfic2.
(The format of our PDB-style files is described here.)

Timeline for d1nfic2: