Class b: All beta proteins [48724] (141 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (6 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49429] (7 PDB entries) |
Domain d1vkxa2: 1vkx A:19-191 [22454] Other proteins in same PDB: d1vkxa1, d1vkxb1, d1vkxb2 protein/DNA complex |
PDB Entry: 1vkx (more details), 2.9 Å
SCOP Domain Sequences for d1vkxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vkxa2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)} ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt
Timeline for d1vkxa2: