![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
![]() | Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries) |
![]() | Domain d1ramb2: 1ram B:19-191 [22453] Other proteins in same PDB: d1rama1, d1ramb1 protein/DNA complex; complexed with dtt |
PDB Entry: 1ram (more details), 2.7 Å
SCOP Domain Sequences for d1ramb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ramb2 b.2.5.3 (B:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt
Timeline for d1ramb2: