SCOPe 2.08: Domain d4kv8a2: 4kv8 A:430-554

Lineage for d4kv8a2 (4kv8 A:430-554)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d4kv8a2: 4kv8 A:430-554 [224482]
   Other proteins in same PDB: d4kv8a1, d4kv8b_
   automated match to d1bqna1
   complexed with 1wt, mla

Details for d4kv8a2

PDB Entry: 4kv8, 2.3 Å

PDB Description: crystal structure of hiv rt in complex with bilr0355bs

PDB Compounds: (A:) HIV Reverse transcriptase P66

SCOPe Domain Sequences for d4kv8a2:

Sequence; same for both SEQRES and ATOM records:

>d4kv8a2 c.55.3.0 (A:430-554) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d4kv8a2:

• d4kv8a2 first appeared in SCOPe 2.03
  
• d4kv8a2 appears in SCOPe 2.07