Lineage for d4kuci_ (4kuc I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233472Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2233473Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2233474Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2233575Protein Ricin A-chain [56389] (1 species)
  7. 2233576Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (48 PDB entries)
    Uniprot P06750 28-286
  8. 2233622Domain d4kuci_: 4kuc I: [224476]
    Other proteins in same PDB: d4kucd1, d4kucd2, d4kuce_
    automated match to d1il4a_
    protein/RNA complex

Details for d4kuci_

PDB Entry: 4kuc (more details), 2.79 Å

PDB Description: Crystal structure of ricin-A chain in complex with the antibody 6C2
PDB Compounds: (I:) ricin

SCOPe Domain Sequences for d4kuci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kuci_ d.165.1.1 (I:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
qypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsn
haelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnyd
rleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyi
egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvyd
vsilipiialmvyrcappp

SCOPe Domain Coordinates for d4kuci_:

Click to download the PDB-style file with coordinates for d4kuci_.
(The format of our PDB-style files is described here.)

Timeline for d4kuci_: