SCOPe 2.08: Domain d1a3qa2: 1a3q A:37-226

Lineage for d1a3qa2 (1a3q A:37-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein p52 subunit of NF-kappa B (NFKB), N-terminal domain [49426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49427] (1 PDB entry)

8. Domain d1a3qa2: 1a3q A:37-226 [22447]
   Other proteins in same PDB: d1a3qa1, d1a3qb1
   protein/DNA complex

Details for d1a3qa2

PDB Entry: 1a3q, 2.1 Å

PDB Description: human nf-kappa-b p52 bound to dna

PDB Compounds: (A:) protein (nuclear factor kappa-b p52)

SCOPe Domain Sequences for d1a3qa2:

Sequence; same for both SEQRES and ATOM records:

>d1a3qa2 b.2.5.3 (A:37-226) p52 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gpylviveqpkqrgfrfrygcegpshgglpgassekgrktyptvkicnyegpakievdlv
thsdpprahahslvgkqcselgicavsvgpkdmtaqfnnlgvlhvtkknmmgtmiqklqr
qrlrsrpqglteaeqreleqeakelkkvmdlsivrlrfsaflrslplkpvisqpihdsks
pgas

Timeline for d1a3qa2:

• d1a3qa2 first appeared (with stable ids) in SCOP 1.55
  
• d1a3qa2 appears in SCOPe 2.07