Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) |
Domain d4krpb_: 4krp B: [224464] Other proteins in same PDB: d4krpc1, d4krpc2 automated match to d4jvpa_ complexed with nag |
PDB Entry: 4krp (more details), 2.82 Å
SCOPe Domain Sequences for d4krpb_:
Sequence, based on SEQRES records: (download)
>d4krpb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} evqlvesggglvqaggslrlscaasgrtfssyamgwfrqapgkerefvvainwssgstyy adsvkgrftisrdnakntmylqmnslkpedtavyycaagyqinsgnynfkdyeydywgqg tqvt
>d4krpb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} evqlvesgggllscaasgrtfssyamgwfrqapgkerefvvainwssgstyyadsvkgrf tisrdnakntmylqmnslkpedtavyycaagyqinsgnynfkdyeydywgqgtqvt
Timeline for d4krpb_: