SCOPe 2.03: Domain d4krml_: 4krm L:

Lineage for d4krml_ (4krm L:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d4krml_: 4krm L: [224462]
   automated match to d4jvpa_
   complexed with nag

Details for d4krml_

PDB Entry: 4krm, 2.65 Å

PDB Description: nanobody/vhh domain 7d12 in complex with domain iii of the extracellular region of egfr, ph 3.5

PDB Compounds: (L:) Nanobody/VHH domain 7D12

SCOPe Domain Sequences for d4krml_:

Sequence; same for both SEQRES and ATOM records:

>d4krml_ b.1.1.1 (L:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesgggsvqtggslrltcaasgrtsrsygmgwfrqapgkerefvsgiswrgdstgy
adsvkgrftisrdnakntvdlqmnslkpedtaiyycaaaagsawygtlyeydywgqgtqv
tvss

Timeline for d4krml_:

• d4krml_ is new in SCOPe 2.03-stable
  
• d4krml_ appears in SCOPe 2.04
  
• d4krml_ appears in the current release, SCOPe 2.08