Lineage for d1nfkb2 (1nfk B:39-250)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223784Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 223803Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 223807Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)
  7. 223810Species Mouse (Mus musculus) [TaxId:10090] [49425] (2 PDB entries)
  8. 223812Domain d1nfkb2: 1nfk B:39-250 [22445]
    Other proteins in same PDB: d1nfka1, d1nfkb1
    protein/DNA complex

Details for d1nfkb2

PDB Entry: 1nfk (more details), 2.3 Å

PDB Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer

SCOP Domain Sequences for d1nfkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfkb2 b.2.5.3 (B:39-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus)}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasnlki

SCOP Domain Coordinates for d1nfkb2:

Click to download the PDB-style file with coordinates for d1nfkb2.
(The format of our PDB-style files is described here.)

Timeline for d1nfkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfkb1