Lineage for d4ko4t_ (4ko4 T:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019070Species Desulfomicrobium baculatum [TaxId:899] [226720] (6 PDB entries)
  8. 3019082Domain d4ko4t_: 4ko4 T: [224430]
    Other proteins in same PDB: d4ko4l_, d4ko4m_
    automated match to d1cc1s_
    complexed with ca, cl, fco, gol, h2s, ni, sf4

Details for d4ko4t_

PDB Entry: 4ko4 (more details), 2 Å

PDB Description: high x-ray dose structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
PDB Compounds: (T:) Periplasmic [NiFeSe] hydrogenase small subunit

SCOPe Domain Sequences for d4ko4t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ko4t_ e.19.1.1 (T:) automated matches {Desulfomicrobium baculatum [TaxId: 899]}
akkapviwvqgqgctgcsvsllnavhprikeilldvislefhptvmasegemalahmyei
aekfngnffllvegaiptakegrycivgetldakghhhevtmmelirdlapkslatvavg
tcsayggipaaegnvtgsksvrdffadekiekllvnvpgcpphpdwmvgtlvaawshvln
ptehplpeldddgrpllffgdnihencpyldkydnsefaetftkpgckaelgckgpstya
dcakrrwnnginwcvenavcigcvepdfpdgkspfyvae

SCOPe Domain Coordinates for d4ko4t_:

Click to download the PDB-style file with coordinates for d4ko4t_.
(The format of our PDB-style files is described here.)

Timeline for d4ko4t_: