SCOPe 2.08: Domain d4kndb_: 4knd B:

Lineage for d4kndb_ (4knd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Anaeromyxobacter dehalogenans [TaxId:290397] [226674] (1 PDB entry)

8. Domain d4kndb_: 4knd B: [224408]
   automated match to d1xfla_

Details for d4kndb_

PDB Entry: 4knd, 1.9 Å

PDB Description: thioredoxin from anaeromyxobacter dehalogenans.

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d4kndb_:

Sequence; same for both SEQRES and ATOM records:

>d4kndb_ c.47.1.0 (B:) automated matches {Anaeromyxobacter dehalogenans [TaxId: 290397]}
dvvvlqdstfeqevlksdtpvlvdfwavwcgpckaiapvvddlaarykgklkvakmdvdq
hqgvpqqygirsiptllvfkggrvvdtvigadktrledsvkkai

Timeline for d4kndb_:

• d4kndb_ first appeared in SCOPe 2.03
  
• d4kndb_ appears in SCOPe 2.07