Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
Domain d1a02n2: 1a02 N:399-576 [22440] Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n1 protein/DNA complex |
PDB Entry: 1a02 (more details), 2.7 Å
SCOPe Domain Sequences for d1a02n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a02n2 b.2.5.3 (N:399-576) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsahe
Timeline for d1a02n2: