Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
Protein DNA polymerase beta [81579] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries) |
Domain d4klua2: 4klu A:92-148 [224395] Other proteins in same PDB: d4klua1, d4klua3 automated match to d1tv9a2 protein/DNA complex; complexed with mn, na |
PDB Entry: 4klu (more details), 1.97 Å
SCOPe Domain Sequences for d4klua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4klua2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d4klua2: