Lineage for d1tsrb_ (1tsr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2767927Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2767928Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)
  8. 2768044Domain d1tsrb_: 1tsr B: [22438]
    protein/DNA complex; complexed with zn

Details for d1tsrb_

PDB Entry: 1tsr (more details), 2.2 Å

PDB Description: p53 core domain in complex with dna
PDB Compounds: (B:) protein (p53 tumor suppressor)

SCOPe Domain Sequences for d1tsrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tsrb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d1tsrb_:

Click to download the PDB-style file with coordinates for d1tsrb_.
(The format of our PDB-style files is described here.)

Timeline for d1tsrb_: