Lineage for d1ayob_ (1ayo B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) 
Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins) Protein alpha-2-macroglobulin [49414] (2 species) Species Cow (Bos taurus) [TaxId:9913] [49416] (1 PDB entry) 
Domain d1ayob_: 1ayo B: [22432]
Details for d1ayob_
PDB Entry: 1ayo (more details), 1.9 Å
PDB Description: receptor binding domain of bovine alpha-2-macroglobulin
SCOP Domain Sequences for d1ayob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayob_ b.2.4.1 (B:) alpha-2-macroglobulin {Cow (Bos taurus)}
efpfalevqtlpqtcdgpkahtsfqislsvsyigsrpasnmaivdvkmvsgfiplkptvk
mlersnvsrtevsnnhvliyldkvtnetltltftvlqdipvrdlkpaivkvydyyetdef
avaeysapcs
SCOP Domain Coordinates for d1ayob_:
Click to download the PDB-style file with coordinates for d1ayob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayob_:
- d1ayob_ appears in SCOP 1.57
- d1ayob_ appears in the current release, SCOPe 2.08
View in 3D
