Lineage for d4kiod_ (4kio D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673870Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1673871Species Human (Homo sapiens) [TaxId:9606] [111195] (28 PDB entries)
    Uniprot Q08881 357-619
  8. 1673901Domain d4kiod_: 4kio D: [224299]
    automated match to d3miya_
    complexed with g5k, g6k, gol, so4; mutant

Details for d4kiod_

PDB Entry: 4kio (more details), 2.18 Å

PDB Description: Kinase domain mutant of human Itk in complex with a covalently-binding inhibitor
PDB Compounds: (D:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4kiod_:

Sequence, based on SEQRES records: (download)

>d4kiod_ d.144.1.7 (D:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaes

Sequence, based on observed residues (ATOM records): (download)

>d4kiod_ d.144.1.7 (D:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiseedfieeaevmmklshpklv
qlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvi
hrdlaarnclvgenqvikvsdfgmpvkwaspevfsfsryssksdvwsfgvlmwevfsegk
ipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeia
es

SCOPe Domain Coordinates for d4kiod_:

Click to download the PDB-style file with coordinates for d4kiod_.
(The format of our PDB-style files is described here.)

Timeline for d4kiod_: