SCOPe 2.04: Domain d4kioc_: 4kio C:

Lineage for d4kioc_ (4kio C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (28 PDB entries)
   Uniprot Q08881 357-619

8. Domain d4kioc_: 4kio C: [224298]
   automated match to d3miya_
   complexed with g5k, g6k, gol, so4; mutant

Details for d4kioc_

PDB Entry: 4kio, 2.18 Å

PDB Description: Kinase domain mutant of human Itk in complex with a covalently-binding inhibitor

PDB Compounds: (C:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4kioc_:

Sequence, based on SEQRES records:

>d4kioc_ d.144.1.7 (C:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaesgl

Sequence, based on observed residues (ATOM records):

>d4kioc_ d.144.1.7 (C:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtfpvkwaspevfsfsryssksdvwsfgvlmw
evfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrll
rqlaeiaesgl

Timeline for d4kioc_:

• d4kioc_ first appeared in SCOPe 2.03
  
• d4kioc_ appears in SCOPe 2.05
  
• d4kioc_ appears in the current release, SCOPe 2.08, called d4kioc1