Lineage for d4kioc_ (4kio C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435504Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1435505Species Human (Homo sapiens) [TaxId:9606] [111195] (26 PDB entries)
    Uniprot Q08881 357-619
  8. 1435523Domain d4kioc_: 4kio C: [224298]
    automated match to d3miya_
    complexed with g5k, g6k, gol, so4; mutant

Details for d4kioc_

PDB Entry: 4kio (more details), 2.18 Å

PDB Description: Kinase domain mutant of human Itk in complex with a covalently-binding inhibitor
PDB Compounds: (C:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4kioc_:

Sequence, based on SEQRES records: (download)

>d4kioc_ d.144.1.7 (C:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaesgl

Sequence, based on observed residues (ATOM records): (download)

>d4kioc_ d.144.1.7 (C:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtfpvkwaspevfsfsryssksdvwsfgvlmw
evfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrll
rqlaeiaesgl

SCOPe Domain Coordinates for d4kioc_:

Click to download the PDB-style file with coordinates for d4kioc_.
(The format of our PDB-style files is described here.)

Timeline for d4kioc_: