| Class b: All beta proteins [48724] (174 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) ![]() |
| Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins) |
| Protein alpha-1-macroglobulin [49412] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry) |
| Domain d1edya_: 1edy A: [22428] |
PDB Entry: 1edy (more details), 2.3 Å
SCOPe Domain Sequences for d1edya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edya_ b.2.4.1 (A:) alpha-1-macroglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapfssds
Timeline for d1edya_: