Lineage for d1pdkb_ (1pdk B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10375Superfamily b.2.3: Bacterial adhesins [49401] (2 families) (S)
  5. 10380Family b.2.3.2: Pilus subunits [49405] (2 proteins)
  6. 10399Protein PapK pilus subunit [49408] (1 species)
  7. 10400Species Escherichia coli [TaxId:562] [49409] (1 PDB entry)
  8. 10401Domain d1pdkb_: 1pdk B: [22427]
    Other proteins in same PDB: d1pdka1, d1pdka2

Details for d1pdkb_

PDB Entry: 1pdk (more details), 2.4 Å

PDB Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus

SCOP Domain Sequences for d1pdkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdkb_ b.2.3.2 (B:) PapK pilus subunit {Escherichia coli}
lldrpchvsgdslnkhvvfktrasrdfwyppgrsptesfvirlenchatavgkivtltfk
gteeaalpghlkvtgvnagrlgialldtdgssllkpgtshnkgqgekvtgnslelpfgay
vvatpealrtksvvpgdyeatatfeltyr

SCOP Domain Coordinates for d1pdkb_:

Click to download the PDB-style file with coordinates for d1pdkb_.
(The format of our PDB-style files is described here.)

Timeline for d1pdkb_: