SCOPe 2.08: Domain d1pdkb_: 1pdk B:

Lineage for d1pdkb_ (1pdk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein PapK pilus subunit [49408] (1 species)
   similar to C-terminal domain of FimH

7. Species Escherichia coli [TaxId:562] [49409] (1 PDB entry)

8. Domain d1pdkb_: 1pdk B: [22427]
   Other proteins in same PDB: d1pdka1, d1pdka2

Details for d1pdkb_

PDB Entry: 1pdk, 2.4 Å

PDB Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus

PDB Compounds: (B:) protein (protein papk)

SCOPe Domain Sequences for d1pdkb_:

Sequence; same for both SEQRES and ATOM records:

>d1pdkb_ b.2.3.2 (B:) PapK pilus subunit {Escherichia coli [TaxId: 562]}
lldrpchvsgdslnkhvvfktrasrdfwyppgrsptesfvirlenchatavgkivtltfk
gteeaalpghlkvtgvnagrlgialldtdgssllkpgtshnkgqgekvtgnslelpfgay
vvatpealrtksvvpgdyeatatfeltyr

Timeline for d1pdkb_:

• d1pdkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pdkb_ appears in SCOPe 2.07