Lineage for d4kdza_ (4kdz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921214Family c.116.1.1: SpoU-like RNA 2'-O ribose methyltransferase [75218] (5 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546
  6. 2921235Protein automated matches [191165] (4 species)
    not a true protein
  7. 2921236Species Escherichia coli [TaxId:364106] [226743] (1 PDB entry)
  8. 2921237Domain d4kdza_: 4kdz A: [224260]
    automated match to d3n4ka_

Details for d4kdza_

PDB Entry: 4kdz (more details), 2.32 Å

PDB Description: Crystal structure of tRNA/rRNA methyltransferase YibK from Escherichia coli (Target NYSGRC-012599)
PDB Compounds: (A:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4kdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdza_ c.116.1.1 (A:) automated matches {Escherichia coli [TaxId: 364106]}
mlnivlyepeippntgniirlcantgfrlhiiepmgfawddkrlrragldyheftavtrh
hdyrafleaenpqrlfalttkgtpahsavsyqdgdylmfgpetrglpasildalpaeqki
ripmvpdsrsmnlsnavsvvvyeawrqlgypgavlr

SCOPe Domain Coordinates for d4kdza_:

Click to download the PDB-style file with coordinates for d4kdza_.
(The format of our PDB-style files is described here.)

Timeline for d4kdza_: