SCOPe 2.08: Domain d4kdya2: 4kdy A:86-220

Lineage for d4kdya2 (4kdy A:86-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)

8. Domain d4kdya2: 4kdy A:86-220 [224257]
   Other proteins in same PDB: d4kdya1, d4kdya3, d4kdyb1, d4kdyb3
   automated match to d1e6ba1
   complexed with cit, gol, gsh

Details for d4kdya2

PDB Entry: 4kdy, 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site

PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kdya2:

Sequence; same for both SEQRES and ATOM records:

>d4kdya2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapppdrrtp

Timeline for d4kdya2:

• d4kdya2 first appeared in SCOPe 2.03
  
• d4kdya2 appears in SCOPe 2.07