SCOPe 2.08: Domain d4k8za1: 4k8z A:1-347

Lineage for d4k8za1 (4k8z A:1-347)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:69014] [226698] (1 PDB entry)

8. Domain d4k8za1: 4k8z A:1-347 [224214]
   Other proteins in same PDB: d4k8za2
   automated match to d1qqca1
   protein/DNA complex; complexed with edo, mg, nco

Details for d4k8za1

PDB Entry: 4k8z, 2.29 Å

PDB Description: kod polymerase in binary complex with dsdna

PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4k8za1:

Sequence; same for both SEQRES and ATOM records:

>d4k8za1 c.55.3.0 (A:1-347) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafaiatlyhegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs

Timeline for d4k8za1:

• d4k8za1 first appeared in SCOPe 2.03
  
• d4k8za1 appears in SCOPe 2.07