Lineage for d4k6lf_ (4k6l F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548661Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2548662Protein automated matches [190734] (13 species)
    not a true protein
  7. 2548704Species Salmonella enterica [TaxId:90370] [226727] (1 PDB entry)
  8. 2548705Domain d4k6lf_: 4k6l F: [224184]
    Other proteins in same PDB: d4k6lg_
    automated match to d1sr4b_
    complexed with gol

Details for d4k6lf_

PDB Entry: 4k6l (more details), 2.39 Å

PDB Description: Structure of Typhoid Toxin
PDB Compounds: (F:) Cytolethal distending toxin subunit B homolog

SCOPe Domain Sequences for d4k6lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k6lf_ d.151.1.0 (F:) automated matches {Salmonella enterica [TaxId: 90370]}
nisdykvmtwnlqgssasteskwnvnvrqllsgtagvdilmvqeagavptsavptgrhiq
pfgvgipideytwnlgttsrqdiryiyhsaidvgarrvnlaivsrqradnvyvlrpttva
srpvigiglgndvfltahalasggpdaaaivrvtinffrqpqmrhlswflagdfnrspdr
lendlmtehlervvavlapteptqigggildygvivdrapysqrvealrnpqlasdhypv
aflarsc

SCOPe Domain Coordinates for d4k6lf_:

Click to download the PDB-style file with coordinates for d4k6lf_.
(The format of our PDB-style files is described here.)

Timeline for d4k6lf_: