Lineage for d4k3dl2 (4k3d L:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754143Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)
  8. 2754145Domain d4k3dl2: 4k3d L:108-212 [224132]
    automated match to d1aqkl2
    complexed with cit, k

Details for d4k3dl2

PDB Entry: 4k3d (more details), 1.85 Å

PDB Description: Crystal structure of bovine antibody BLV1H12 with ultralong CDR H3
PDB Compounds: (L:) bovine antibody with ultralong cdr h3, light chain

SCOPe Domain Sequences for d4k3dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k3dl2 b.1.1.0 (L:108-212) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq
snskyaassylsltssdwkskgsyscevthegstvtktvkpsecs

SCOPe Domain Coordinates for d4k3dl2:

Click to download the PDB-style file with coordinates for d4k3dl2.
(The format of our PDB-style files is described here.)

Timeline for d4k3dl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k3dl1