Lineage for d4k2wb2 (4k2w B:84-199)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411453Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1411454Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1411726Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1411727Protein automated matches [226860] (25 species)
    not a true protein
  7. 1411741Species Babesia bovis [TaxId:5865] [226663] (1 PDB entry)
  8. 1411743Domain d4k2wb2: 4k2w B:84-199 [224128]
    Other proteins in same PDB: d4k2wa1, d4k2wb1
    automated match to d1gv3a2
    complexed with zn

Details for d4k2wb2

PDB Entry: 4k2w (more details), 1.75 Å

PDB Description: x-ray crystal structure of superoxide dismutase from babesia bovis solved by sulfur/zinc sad
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4k2wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k2wb2 d.44.1.0 (B:84-199) automated matches {Babesia bovis [TaxId: 5865]}
ncggeptgpirkkieekfgsfsafktdfsnllaghfgsgwgwlvlkddgtadivqthdag
splkenlgrpllccdvwehayyidykndrlsyinswwnlvnwdfanknleapfkws

SCOPe Domain Coordinates for d4k2wb2:

Click to download the PDB-style file with coordinates for d4k2wb2.
(The format of our PDB-style files is described here.)

Timeline for d4k2wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4k2wb1