![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (5 families) ![]() |
![]() | Family b.2.3.1: Collagen-binding domain of adhesin [49402] (1 protein) |
![]() | Protein Collagen-binding domain of adhesin [49403] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [49404] (1 PDB entry) |
![]() | Domain d1amx__: 1amx - [22410] |
PDB Entry: 1amx (more details), 2 Å
SCOP Domain Sequences for d1amx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amx__ b.2.3.1 (-) Collagen-binding domain of adhesin {Staphylococcus aureus} tssvfyyktgdmlpedtthvrwflninneksyvskditikdqiqggqqldlstlninvtg thsnyysgqsaitdfekafpgskitvdntkntidvtipqgygsynsfsinyktkitneqq kefvnnsqawyqehgkeevngksfnhtvhn
Timeline for d1amx__: