Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Thermoplasma volcanium [TaxId:273116] [226642] (1 PDB entry) |
Domain d4jyld1: 4jyl D:1-242 [224082] Other proteins in same PDB: d4jyla2, d4jylb2, d4jylc2, d4jyld2, d4jyle2 automated match to d2duba_ complexed with cl, so4 |
PDB Entry: 4jyl (more details), 2.37 Å
SCOPe Domain Sequences for d4jyld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jyld1 c.14.1.0 (D:1-242) automated matches {Thermoplasma volcanium [TaxId: 273116]} mlveierrgdaslivlsrpeklnainlemladladqfskaekedtrvivitgygknfsag adinmlasfdpasaysfrlkmnsiaqrirksdkpviallkgysmggglelaesadiriam sdavigqpessiginagaggnvilpklvgrgsaaylamsgkklnaqeamalglvdevvdd eakawkiiddickkpkktlqfikrainssydmglesamdqealyfsllftdpevldalsk wr
Timeline for d4jyld1: