Lineage for d1qbba2 (1qbb A:28-200)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040342Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2040456Family b.2.2.3: Bacterial chitobiase, n-terminal domain [49398] (1 protein)
    automatically mapped to Pfam PF03173
  6. 2040457Protein Bacterial chitobiase, n-terminal domain [49399] (1 species)
  7. 2040458Species Serratia marcescens [TaxId:615] [49400] (4 PDB entries)
  8. 2040461Domain d1qbba2: 1qbb A:28-200 [22407]
    Other proteins in same PDB: d1qbba1, d1qbba3, d1qbba4
    complexed with cbs, so4

Details for d1qbba2

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)
PDB Compounds: (A:) chitobiase

SCOPe Domain Sequences for d1qbba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbba2 b.2.2.3 (A:28-200) Bacterial chitobiase, n-terminal domain {Serratia marcescens [TaxId: 615]}
dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfv

SCOPe Domain Coordinates for d1qbba2:

Click to download the PDB-style file with coordinates for d1qbba2.
(The format of our PDB-style files is described here.)

Timeline for d1qbba2: