Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Sinorhizobium meliloti [TaxId:266834] [226660] (2 PDB entries) |
Domain d4jxqb_: 4jxq B: [224062] automated match to d3dr6a_ complexed with 2pe, edo, flc, peg |
PDB Entry: 4jxq (more details), 1.15 Å
SCOPe Domain Sequences for d4jxqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jxqb_ d.108.1.0 (B:) automated matches {Sinorhizobium meliloti [TaxId: 266834]} mtatlrdavaadlrsiteiyresvlngvatyeetppseaemalrfstitgngypyvvald ergavigyayasafrnrtayrflvedsiylspeargkgigkallselvgrctalgfrqmi aviggahpssialhralgfelqglmkatgfkhgrwldtafmqrplgegtatkptegvypd tlyrs
Timeline for d4jxqb_: