Lineage for d4jx1h_ (4jx1 H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179171Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2179172Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2179224Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (19 PDB entries)
  8. 2179236Domain d4jx1h_: 4jx1 H: [224058]
    Other proteins in same PDB: d4jx1a_, d4jx1b_, d4jx1e_, d4jx1f_
    automated match to d4jwud_
    complexed with 1n0, ca, cah, cam, fes, hem

Details for d4jx1h_

PDB Entry: 4jx1 (more details), 2.09 Å

PDB Description: crystal structure of reduced cytochrome p450cam-putidaredoxin complex bound to camphor and 5-exo-hydroxycamphor
PDB Compounds: (H:) putidaredoxin

SCOPe Domain Sequences for d4jx1h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jx1h_ d.15.4.1 (H:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]}
skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw

SCOPe Domain Coordinates for d4jx1h_:

Click to download the PDB-style file with coordinates for d4jx1h_.
(The format of our PDB-style files is described here.)

Timeline for d4jx1h_: