SCOP 1.75: Domain d1aoha_: 1aoh A:

Lineage for d1aoha_ (1aoh A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (8 proteins)
   Pfam PF00963

6. Protein Cohesin domain [49396] (2 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (5 PDB entries)

8. Domain d1aoha_: 1aoh A: [22401]
   cohesin domain from scaffolding protein CipA

Details for d1aoha_

PDB Entry: 1aoh, 1.7 Å

PDB Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome

PDB Compounds: (A:) cellulosome-integrating protein cipa

SCOP Domain Sequences for d1aoha_:

Sequence; same for both SEQRES and ATOM records:

>d1aoha_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules [TaxId: 1515]}
avrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgelivdpn
ptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvikfvev
ggfanndlveqktqffdggvnvg

Timeline for d1aoha_:

• d1aoha_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoha_ appears in SCOP 1.73
  
• d1aoha_ appears in SCOPe 2.01
  
• d1aoha_ appears in the current release, SCOPe 2.08