Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [226630] (3 PDB entries) |
Domain d4jrha1: 4jrh A:3-252 [223957] automated match to d2alma1 complexed with act |
PDB Entry: 4jrh (more details), 2.2 Å
SCOPe Domain Sequences for d4jrha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jrha1 c.95.1.0 (A:3-252) automated matches {Vibrio cholerae [TaxId: 243277]} krrvvvtgmgmlspvgntvesswkallagqsgivniehfdttnfstrfaglvkgfdceqy mskkdarkmdlfiqygiaagiqaledsglevneenaarigvaigsgigglelietghqal iekgprkvspffvpstivnmiagnlsimrglrgpniaistacttglhnighaarmiaygd adamvaggaekastplgmagfgaakalstrndepqkasrpwdkdrdgfvlgdgagimvle eyehakarga
Timeline for d4jrha1: