SCOPe 2.06: Domain d4josb1: 4jos B:2-228

Lineage for d4josb1 (4jos B:2-228)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (41 species)
   not a true protein

7. Species Francisella philomiragia [TaxId:484022] [226629] (1 PDB entry)

8. Domain d4josb1: 4jos B:2-228 [223926]
   Other proteins in same PDB: d4josa2, d4josb2
   automated match to d3eeia_
   complexed with ade, edo, na

Details for d4josb1

PDB Entry: 4jos, 1.45 Å

PDB Description: crystal structure of a putative 5'-methylthioadenosine/s- adenosylhomocysteine nucleosidase from francisella philomiragia atcc 25017 (target nysgrc-029335)

PDB Compounds: (B:) Adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d4josb1:

Sequence; same for both SEQRES and ATOM records:

>d4josb1 c.56.2.0 (B:2-228) automated matches {Francisella philomiragia [TaxId: 484022]}
kkiailgameieiqpilqklekyetveyannkyyvanyngielvvayskigkvfssltat
imiehfgvdallftgvagglqdlqvgdmiaatatvqhdvditafgypygkipiseveiat
sarileqakviakelnlnlhtgviatgdqfvhsaerkdfvvkefdakaiemegasvnlic
nemnipsfilrsisdtadgdapdnfdefakmaanrsadfvmklvdri

Timeline for d4josb1:

• d4josb1 first appeared in SCOPe 2.03, called d4josb_
  
• d4josb1 was called d4josb_ in SCOPe 2.05
  
• d4josb1 appears in SCOPe 2.07
  
• d4josb1 appears in the current release, SCOPe 2.08