Lineage for d4jnkb2 (4jnk B:160-331)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1440940Protein Lactate dehydrogenase [56339] (18 species)
  7. 1440990Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (3 PDB entries)
  8. 1440992Domain d4jnkb2: 4jnk B:160-331 [223914]
    Other proteins in same PDB: d4jnka1, d4jnkb1, d4jnkc1, d4jnkd1
    automated match to d1i10a2
    complexed with epe, lac, nai, so4, zhk

Details for d4jnkb2

PDB Entry: 4jnk (more details), 1.9 Å

PDB Description: Lactate Dehydrogenase A in complex with inhibitor compound 22
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4jnkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jnkb2 d.162.1.1 (B:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4jnkb2:

Click to download the PDB-style file with coordinates for d4jnkb2.
(The format of our PDB-style files is described here.)

Timeline for d4jnkb2: