SCOPe 2.06: Domain d4jkea_: 4jke A:

Lineage for d4jkea_ (4jke A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.14: Prp8 beta-finger domain-like [159638] (2 proteins)
   automatically mapped to Pfam PF12134

6. Protein Pre-mRNA-splicing factor 8, Prp8 [159639] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159640] (13 PDB entries)
   Uniprot Q6P2Q9 1760-2016! Uniprot Q6P2Q9 1771-1989

8. Domain d4jkea_: 4jke A: [223866]
   automated match to d3enba1
   complexed with mg

Details for d4jkea_

PDB Entry: 4jke, 1.65 Å

PDB Description: Open and closed forms of T1789P human PRP8 RNase H-like domain with bound Mg ion

PDB Compounds: (A:) Pre-mRNA-processing-splicing factor 8

SCOPe Domain Sequences for d4jkea_:

Sequence, based on SEQRES records:

>d4jkea_ c.55.3.14 (A:) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]}
lfsnqiiwfvddtnvyrvpihktfegnlttkpingaififnprtgqlflkiihtsvwagq
krlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselq
lpfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndra
kvilkpdkttitephhiwptltdeewikvevqlkdlilad

Sequence, based on observed residues (ATOM records):

>d4jkea_ c.55.3.14 (A:) Pre-mRNA-splicing factor 8, Prp8 {Human (Homo sapiens) [TaxId: 9606]}
lfsqiiwfvddtnvyrvpihktfegnlttkpingaififnprtgqlflkiihtsvwagqk
rlgqlakwktaeevaalirslpveeqpkqiivtrkgmldplevhlldfpnivikgselql
pfqaclkvekfgdlilkatepqmvlfnlyddwlktissytafsrlililralhvnndrak
vilkpdkttitephhiwptltdeewikvevqlkdlilad

Timeline for d4jkea_:

• d4jkea_ first appeared in SCOPe 2.03
  
• d4jkea_ appears in SCOPe 2.05
  
• d4jkea_ appears in SCOPe 2.07
  
• d4jkea_ appears in the current release, SCOPe 2.08