Lineage for d4jj5a2 (4jj5 A:119-207)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370761Domain d4jj5a2: 4jj5 A:119-207 [223844]
    automated match to d1nj9a2

Details for d4jj5a2

PDB Entry: 4jj5 (more details), 2.44 Å

PDB Description: crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
PDB Compounds: (A:) 1c2 fab light chain

SCOPe Domain Sequences for d4jj5a2:

Sequence, based on SEQRES records: (download)

>d4jj5a2 b.1.1.0 (A:119-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptkegn
kfmassflhltsdqwrshnsftcqvtheg

Sequence, based on observed residues (ATOM records): (download)

>d4jj5a2 b.1.1.0 (A:119-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kstptltvfppsseelkenkatlvclisnfspsgvtvawgvdtsnptfmassflhtcqvt
heg

SCOPe Domain Coordinates for d4jj5a2:

Click to download the PDB-style file with coordinates for d4jj5a2.
(The format of our PDB-style files is described here.)

Timeline for d4jj5a2: