SCOPe 2.04: Domain d4jj5a1: 4jj5 A:1-115

Lineage for d4jj5a1 (4jj5 A:1-115)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4jj5a1: 4jj5 A:1-115 [223843]
   automated match to d1nj9a1

Details for d4jj5a1

PDB Entry: 4jj5, 2.44 Å

PDB Description: crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine

PDB Compounds: (A:) 1c2 fab light chain

SCOPe Domain Sequences for d4jj5a1:

Sequence; same for both SEQRES and ATOM records:

>d4jj5a1 b.1.1.0 (A:1-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlvltqsssasfslgasakltctlsrqhstytiewyqqqplkppkfvmelkkdgshstgd
gipdrfsgsssgahrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvl

Timeline for d4jj5a1:

• d4jj5a1 first appeared in SCOPe 2.03
  
• d4jj5a1 appears in SCOPe 2.05
  
• d4jj5a1 appears in the current release, SCOPe 2.08