SCOPe 2.06: Domain d1toxb1: 1tox B:381-535

Lineage for d1toxb1 (1tox B:381-535)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)

6. Protein Diphtheria toxin, C-terminal domain [49382] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)

8. Domain d1toxb1: 1tox B:381-535 [22384]
   Other proteins in same PDB: d1toxa2, d1toxa3, d1toxb2, d1toxb3
   complexed with nad

Details for d1toxb1

PDB Entry: 1tox, 2.3 Å

PDB Description: diphtheria toxin dimer complexed with nad

PDB Compounds: (B:) diphtheria toxin (dimeric)

SCOPe Domain Sequences for d1toxb1:

Sequence; same for both SEQRES and ATOM records:

>d1toxb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Timeline for d1toxb1:

• d1toxb1 first appeared (with stable ids) in SCOP 1.55
  
• d1toxb1 appears in SCOPe 2.05
  
• d1toxb1 appears in SCOPe 2.07
  
• d1toxb1 appears in the current release, SCOPe 2.08