Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:358] [197106] (5 PDB entries) |
Domain d4jicb_: 4jic B: [223837] automated match to d4jiqa_ complexed with fmn, peg, so4 |
PDB Entry: 4jic (more details), 1.6 Å
SCOPe Domain Sequences for d4jicb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jicb_ c.1.4.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]} tslfepaqagdialanrivmapltrnrspgaipnnlnatyyeqrataglivtegtpisqq gqgyadvpglykreaiegwkkitdgvhsaggkivaqiwhvgrishtslqphggqpvapsa itaksktyiinddgtgafaetsepraltiddigliledyrsgaraaleagfdgveihaan gylieqflksstnqrtddyggsienrarfllevvdavaeeigagrtgirlspvtpandif eadpqplynyvveqlgkrnlafihvvegatggprdfkqgdkpfdyasfkaayrnaggkgl wianngydrqsaieavesgkvdavafgkafianpdlvrrlkndaplnapnqptfygggae gytdypalaq
Timeline for d4jicb_: